PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_557E7700B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 327aa    MW: 36067.8 Da    PI: 7.1761
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_557E7700B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd +lv ++++ G+g+W++++   g+ R+ k+c++rw +yl
  Traes_5BL_557E7700B.1 14 KGPWTPEEDIILVSYIQENGPGNWRAVPINTGLMRCSKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding47.54.1e-1567112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++Tt E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  Traes_5BL_557E7700B.1  67 RGNFTTHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-21564IPR009057Homeodomain-like
PROSITE profilePS5129423.676965IPR017930Myb domain
SuperFamilySSF466894.87E-2911108IPR009057Homeodomain-like
SMARTSM007174.4E-121363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001671.38E-101661No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2365117IPR009057Homeodomain-like
PROSITE profilePS5129417.99266116IPR017930Myb domain
SMARTSM007172.0E-1266114IPR001005SANT/Myb domain
PfamPF002491.4E-1267112IPR001005SANT/Myb domain
CDDcd001679.30E-969111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRPPCCHKV GVKKGPWTPE EDIILVSYIQ ENGPGNWRAV PINTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF TTHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKQQ  120
AMGAIFAPPP PPPSSSAETA INLPGAVHLD NHHHRYHHDA IAASSSTVDH GCYAACSNPE  180
VTQQHTTITM RRSPFADVAA DCSSSSYASS MDNISRLLDG FMKSSPPTAT DVKPNIAVVS  240
DPFMSFDRIS GTGTELAFVP GVQQQQQQPV LMGGISYDDE ATRQQQQLHH QLPLCSIEKW  300
LLDEAAEQVA DLMDLSDGGC SSLPLLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-25141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-25141164105C-Myb DNA-Binding Domain
1msf_C4e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3574780.0AK357478.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1054F12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579000.11e-126PREDICTED: transcription factor MYB30-like
TrEMBLW5FBK90.0W5FBK9_WHEAT; Uncharacterized protein
STRINGMLOC_68511.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-79myb domain protein 60
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]